ONLINE INQUIRY

ActoFactor™ Recombinant Human Chemokine (C-C motif) ligand 4

  • Specification
  • Q & A
  • Customer Review
Cat.No.
CSC-CTK0048
Description
MIP-1b is a member of the b (CC) family of chemokines. It is produced by fibroblasts, monocytes, T and B lymphocytes, neutrophils, smooth muscle cells, mast cells tumor cell lines. MIP-1b is a chemoattractant for monocytes and T cells. In addition, MIP-1b potentiates early hematopoietic precursors growth. The mature protein contains 69 amino acid residue and migrates with an apparent Mr of 7.8 kDa. MIP-1b binds to CCR1, CCR5 and US28.
Species
Human
Product Overview
Human CCL4 expressed in E.coli
Sequence
A DNA sequence (APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN) encoding the mature human MIP-1b protein (Act-2 variant) was expressed in E. coli.
Size
CAT# CSC-CTK0048-10 (10 μg); CAT# CSC-CTK0048-50 (50 μg)
Expression System
E.coli
Purity
Greater than 97% as determined by SDS-PAGE and visualized by silver stain
Activity
Activity was determined by ability to chemoattract cultured human monocytes or mouse BaF/3 cells transfected with hCCR5 and the ED50 for these effects are typically 10 - 30 ng/mL for monocytes and 3 -10 ng/mL for BaF/3 transfected hCCR5 cells.
Endotoxin Level
Endotoxin level less than 0.1ng per 1 μg of the cytokine as determined by the LAL method.
Formulation
Lyophilized from a 0.2 μm filtered solution in 30% acetonitrile and 0.1% TFA, containing 50 μg of bovine serum albumin per 1 μg of cytokine.
Reconstitution
It is recommended that sterile phosphate-buffered saline containing at least 0.1% human serum albumin or bovine serum albumin be added to the vial to prepare a stock solution of no less than 10 μg/mL of the cytokine.
Storage & Stability
Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted MIP-1b/CCL4 can be stored under sterile conditions at 2°C to 4°C for one month or at -20°C to -70°C for three months without detectable loss of activity. Avoid repeated freeze-thaw cycles.
Citation Guidance
If you use this products in your scientific publication, it should be cited in the publication as: Creative Bioarray cat no. If your paper has been published, please click here to submit the PubMed ID of your paper to get a coupon.

Ask a Question

Write your own review

For research use only. Not for any other purpose.